Four and a half lim domains protein 1

Author: jnyj

August undefined, 2024

Webfour and a half LIM domains 1 Synonyms KyoT, KyoT1, KyoT2 Feature Type protein coding gene IDs MGI:1298387 NCBI Gene: 14199 Alliance gene page Transcription Start Sites 20 TSS Location &Maps more Sequence Map ChrX:55777147-55838706 bp, + strand WebJun 20, 2024 · Four and a half LIM domain (FHL) protein family members, FHL1 and FHL2, are multifunctional proteins that are enriched in cardiac muscle. Although they both localize within the cardiomyocyte sarcomere (titin N2B), they have been shown to have important yet unique functions within the context of cardiac hypertrophy and disease.

Loss of FHL1 induces an age-dependent skeletal muscle myopathy ...

WebThe fourth LIM domain of Four and a half LIM domains protein 1 (FHL1): FHL1 is heavily expressed in skeletal and cardiac muscles. It plays important roles in muscle growth, differentiation, and sarcomere assembly by acting as a modulator of transcription factors. book flights to india cheap

Four and a half LIM domain protein signaling and cardiomyopathy …

WebDec 21, 2004 · Four and a half LIM domains protein 5 Short names FHL-5 Alternative names Activator of cAMP-responsive element modulator in testis ( Activator of CREM in testis) Gene names Name FHL5 Synonyms ACT Organism names Organism Homo sapiens (Human) Taxonomic identifier 9606 NCBI Taxonomic lineage WebAug 26, 2008 · The four and a half LIM domain protein 2 (FHL2) was identified as a potential HERG partner. The interaction between these two proteins was confirmed by co-immunoprecipitation and glutathione transferase pull-down assays and immunocytochemical analysis. The physiological implication of HERG–FHL2 interaction, assessed by whole … WebMar 18, 2003 · An interesting subclass of LIM-only proteins is constituted by molecules containing four complete and one amino-terminal half LIM motif. Five proteins share the same structural organization and a high degree of sequence homology in this group: four and half LIM domain protein (FHL) 1, FHL2, FHL3, FHL4, and activator of cAMP … god of war minerai immaculé du royaume

Genes, proteins and complexes: the multifaceted nature …

WebFHL-1 is the predominant complement regulator in Bruch's membrane having direct implications for age-related macular degeneration. Data indicate that four-and-a-half LIM … WebMar 29, 2024 · Some reports have shown a direct binding of LIM domain-containing proteins, such as the four and a half LIM domain protein 2 (FHL-2), to β integrin … book flights to india from canadaWebMay 15, 2024 · FHL1 contains a zinc-finger domain and performs diverse roles in regulation of gene transcription, cytoarchitecture, cell proliferation, and signal transduction. Several … god of war mines rune door

"Webfour and a half LIM domains 1 Normal Function The FHL1 gene provides instructions for making three versions (isoforms) of a protein that plays an important role in muscles used for movement (skeletal muscles) and in the heart (cardiac muscle). The full-length isoform is known as FHL1A, or sometimes just FHL1. " - Four and a half lim domains protein 1

Four and a half lim domains protein 1

WebGene ID: 125353669, updated on 20-May-2024. Summary Other designations. four and a half LIM domains protein 1-like WebJun 20, 2024 · Four and a half LIM domain (FHL) protein family members, FHL1 and FHL2, are multifunctional proteins that are enriched in cardiac muscle. Although they …

Did you know?

WebFour-and-a-half LIM domain 1 gene (FHL1) has recently been identified as the causative gene for reducing body myopathy (RBM), X-linked scapuloperoneal myopathy (SPM) and X-linked myopathy with postural muscle atrophy (XMPMA). Rigid spine is a common clinical feature of the three diseases. We searched for FHL1 mutations in eighteen patients … WebNational Center for Biotechnology Information

WebLIM-only protein 4 (LMO4) and LIM-domain binding protein 1. Squamous cell carcinoma of the head and neck (HNSCC) accounts for more than 300,000 deaths worldwide per … Webaa seq: 320 aa aa seq db search maekfdchycrdplqgkkyvekdghhcclkcfdkfcantcvecrkpigadskevhyknrf whdtcfrcakcfhplasetfvakdnkilcnkcatrgdenprckgcfkalvagdqnveykg ...

WebJul 14, 2016 · Androgen induction of the androgen receptor coactivator four and a half LIM domain protein-2: evidence for a role for serum response factor in prostate cancer. … WebLIM-only protein 4 (LMO4) and LIM-domain binding protein 1. Squamous cell carcinoma of the head and neck (HNSCC) accounts for more than 300,000 deaths worldwide per year as a consequence of tumor cell invasion of adjacent structures or metastasis. LIM-only protein 4 (LMO4) and LIM-domain binding protein 1

WebIntroduction: Four and a half LIM domains protein 1 (FHL1) is the most widely expressed member of the FHL family of proteins, consisting of four and a half highly conserved LIM domains.A multifunctional and integral role for FHL1 has been implicated in muscle development, structural maintenance, and signaling. To date, 27 FHL1 mutations have …

WebIn the present study, using two-hybrid screening, we demonstrated that a zinc finger domain-containing protein, four-and-a-half LIM domains 1 (FHL1), acts as a binding … god of war minimum requirementsWebOct 28, 2011 · Four-and-a-half LIM domain protein 1 isoform A (FHL1A) is predominantly expressed in skeletal and cardiac muscle. Mutations in the FHL1gene are causative for several types of hereditary myopathies including X-linked myopathy with postural muscle atrophy (XMPMA). We here studied myoblasts from XMPMA patients. god of war minimum requirements pcWebSep 21, 2004 · The deduced 284-amino acid protein contains an N-terminal half-LIM domain followed by 4 LIM domains. ACT shares 58.5% identity with FHL2 and 85% identity with mouse Act. Northern blot analysis revealed moderate to high levels of expression in all squamous cell carcinoma, melanoma, and leukemia tumor cell lines tested. book flights to india from new zealandWebCholestasis occurs in different clinical circumstances and leads to severe hepatic disorders. The four-and-a-half LIM-domain protein 2 (FHL2) is a scaffolding protein that modulates multiple signal transduction pathways in a tissue- and cell context-specific manner. In this study, we aimed to gain insight into the function of FHL2 in cholestatic liver injury. FHL2 … god of war minigameWebJan 2, 2006 · The human four-and-a-half-LIM-only protein family consists of the members FHL1, FHL2, FHL3, FHL4 and ACT. They are expressed in a cell- and tissue-specific manner and participate in various cellular processes, including regulation of cell survival, transcription and signal transduction. ... that the HCF-1-processing domain interacts with ... book flights to india from melbourneWebMar 27, 2024 · FOUR-AND-A-HALF LIM DOMAINS 1; FHL1 Alternative titles; symbols SLIM1 FHL1A KYOT, MOUSE, HOMOLOG OF Other entities represented in this entry: … book flights to india from ukWebJan 23, 2007 · Four and a half LIM domains protein 1 Gene FHL1 Status UniProtKB reviewed (Swiss-Prot) Organism Homo sapiens (Human) Amino acids 323 Protein existence Evidence at protein level Annotation score 5/5 Entry Feature viewer … god of war mini bosses